PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Dof
Protein Properties Length: 284aa    MW: 30519.4 Da    PI: 8.8015
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99e-382885461
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  +l+cprCds+ntkfCyynnyslsqPr+fCk+C+ryWt+GG+lrnvPvGgg+rkn+k+
  Lus10014001 28 PQLRCPRCDSANTKFCYYNNYSLSQPRHFCKSCKRYWTRGGTLRNVPVGGGCRKNHKR 85
                 6789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-261784IPR003851Zinc finger, Dof-type
PfamPF027013.3E-322984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0783084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MENPISSSSA ASLAAAGQDN NNNNNQPPQL RCPRCDSANT KFCYYNNYSL SQPRHFCKSC  60
KRYWTRGGTL RNVPVGGGCR KNHKRPNSST PAANKRFPLP LPSSSSSATS TLVLESPNHH  120
NNQINNPLLY GLQHSPAPAA SSHHPHHLVS SLSSNGLEYS GISPSMATLL ASTLNNKFSS  180
SSTSSNGVVK PDHYSGGFEG LQMGIHGVVK AHHQQEQGQD WNINNFGSNQ NNLGWGQVLM  240
NDHHHHHNQV VEGVGSGQEP GYWTGLWSDP GSNNIGPSVT SLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689799e-37AK368979.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2083D03.
GenBankAM0843549e-37AM084354.1 Hordeum vulgare subsp. vulgare dof6 gene for dof zinc finger protein 6, exon 1.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-34TARGET OF MONOPTEROS 6